PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG430400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 311aa    MW: 33373.2 Da    PI: 8.7998
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG430400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM66.48e-21231548126
                  NAM   8 hPtdeelvveyLkkkvegkk......leleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratk...sgyW 83 
                          hP++eel++ +L++++ + +       ++  +i+++d+y++ P +L +      + ++++ wyfFs+ + k+++g+rk r++    +g W
  Pavir.5NG430400.1.p  23 HPSEEELITSFLRPRLGDGSggapcpRPC-AFIHDADVYSAGPDELTRgfdpaVAGNGDSAWYFFSPVRAKNREGQRKARTVGsgeEGCW 111
                          9***************9999888864333.57**************85567755566888********************866445889* PP

                  NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmhey 126
                          ++    ++vl+  g+  g +k++ f ++   + +++ W+m e 
  Pavir.5NG430400.1.p 112 HSEAGARAVLDGAGRCLGHRKSFSFVTKAGGRRVRSGWLMVEL 154
                          ***********9**************9999999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-3012170IPR003441NAC domain
PROSITE profilePS5100527.10416170IPR003441NAC domain
PfamPF023651.0E-1218154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MVVATRRTTA ARPPPPPPDL AAHPSEEELI TSFLRPRLGD GSGGAPCPRP CAFIHDADVY  60
SAGPDELTRG FDPAVAGNGD SAWYFFSPVR AKNREGQRKA RTVGSGEEGC WHSEAGARAV  120
LDGAGRCLGH RKSFSFVTKA GGRRVRSGWL MVELGLGDAH DVALCKIYFS PRARANGGAA  180
AYASSSAGRK RKQAAAAAAD DYPAASPRQR HRGRRPTEAR DDAVTAGAES TQDGGGHADE  240
SSSDRDDGPC GLWKDGMFLP WWMKNRDRLM KEHGIVDRSD EELQKTLGLD KVIKLLNRDY  300
GDSLLFKPSS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1208214QRHRGRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458311.15e-98hypothetical protein SORBIDRAFT_03g031000
TrEMBLC5XGN16e-98C5XGN1_SORBI; Putative uncharacterized protein Sb03g031000
STRINGSb03g031000.12e-97(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.12e-14NAC domain containing protein 35